PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0017s0450.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 266aa    MW: 27607 Da    PI: 5.9253
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0017s0450.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.55.1e-372786362
                  zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            ++ l+cprC+st tkfCy+nny+lsqPr+fCk+CrryWt+GG+lr+vPvGgg+rkn ++s
  SapurV1A.0017s0450.1.p 27 TEPLPCPRCNSTTTKFCYFNNYNLSQPRHFCKSCRRYWTQGGTLRDVPVGGGSRKNSRRS 86
                            67899***************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-232878IPR003851Zinc finger, Dof-type
PfamPF027013.4E-322984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.053084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MPSEISQTHP KEAQNTMGTA PPPSKTTEPL PCPRCNSTTT KFCYFNNYNL SQPRHFCKSC  60
RRYWTQGGTL RDVPVGGGSR KNSRRSRSSS NNSSPSTSSS NSTTSNSATL TALTSIHEPE  120
SIPVSFSSTT DSGVAAVKTD EMPAGINLNE GLAENGNFIS LTGSNDQHGF NGLVGYGYES  180
GFGLGSCEAG LGFGARGFWS FPGMENVADN GGTIGGCTSG CNTWQLQGDH VEGGGGHGGF  240
ATDGENYFGS WPGLAISAPA EKGSD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1469420.0EF146942.1 Populus trichocarpa clone WS01225_E04 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011017255.11e-138PREDICTED: dof zinc finger protein DOF1.6-like
TrEMBLA9PF291e-140A9PF29_POPTR; Putative uncharacterized protein
STRINGPOPTR_0002s13100.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G47655.15e-38Dof family protein